Return to CBI Antibody Core Home Page
  Return to biothreat/emerging pathogens list
    Return to Tuberculosis (Mtb strain H37Rv) ( Mycobacterium tuberculosis H37Rv ) list


Tuberculosis (Mtb strain H37Rv) ( Mycobacterium tuberculosis H37Rv )
Rv3849


Antibody Name/Abbreviation: Rv3849
CBI Antibody Core Code: A1403

"Lot" Number: 1 Position: 58 (75-132)
% Identical Homology of Target to Mouse Protein: 31% (XP_126991.2| similar to pleckstrin homology domain protein (5V327))
Molecular Weight of fusion protein: N.A. KDa

Target sequence used to make this antibody:
FTDDEYYEKLDKELQWLCTMRDDGVRRIAQRAHGLPSAAQ
QKVLDRIDELRRAEGIDA






Sequence Name: Rv3849
Full name:
UniGene Number: N.A.
Accession Number: Rv3849
Source organism: Tuberculosis (Mtb strain H37Rv) ( Mycobacterium tuberculosis H37Rv )
Full length size (aa): 132
NCBI information page:

Full length sequence:
MSTTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGITMSAPYLSQLRS
GNRTNPSGATMAALANFFRIKAAYFTDDEYYEKLDKELQWLCTMRDDGVR
RIAQRAHGLPSAAQQKVLDRIDELRRAEGIDA





Questions? Click here for answers.


© Monday, February 16, 2009 by the CBI Antibody Core and the Center for Biomedical Inventions, University of Texas Southwestern Medical School.