Return to CBI Antibody Core Home Page
  Return to biothreat/emerging pathogens list
    Return to Tuberculosis (Mtb strain H37Rv) ( Mycobacterium tuberculosis H37Rv ) list


Tuberculosis (Mtb strain H37Rv) ( Mycobacterium tuberculosis H37Rv )
Rv3874


Antibody Name/Abbreviation: Rv3874
CBI Antibody Core Code: A1400

"Lot" Number: 1 Position: 84 (16-100)
% Identical Homology of Target to Mouse Protein: 40% (NP_084357.2| zinc finger, FYVE domain containing 20)
Molecular Weight of fusion protein: 23.35 KDa

Target sequence used to make this antibody:
GNFERISGDLKTQIDQVESTAGSLQGQWRGAAGTAAQAAV
VRFQEAANKQKQELDEISTNIRQAGVQYSRADEEQQQALS
SQMGF






Sequence Name: Rv3874
Full name:
UniGene Number: N.A.
Accession Number: NP_218391
Source organism: Tuberculosis (Mtb strain H37Rv) ( Mycobacterium tuberculosis H37Rv )
Full length size (aa): 100
NCBI information page: click here

Full length sequence:
maemktdaatlaqeagnferisgdlktqidqvestagslqgqwrgaagta
aqaavvrfqeaankqkqeldeistnirqagvqysradeeqqqalssqmgf





Questions? Click here for answers.


© Monday, February 16, 2009 by the CBI Antibody Core and the Center for Biomedical Inventions, University of Texas Southwestern Medical School.