| Antibody Name/Abbreviation: Rv3874 CBI Antibody Core Code: A1400 "Lot" Number: 1 Position: 84 (16-100) % Identical Homology of Target to Mouse Protein: 40% (NP_084357.2| zinc finger, FYVE domain containing 20) Molecular Weight of fusion protein: 23.35 KDa Target sequence used to make this antibody: GNFERISGDLKTQIDQVESTAGSLQGQWRGAAGTAAQAAV
VRFQEAANKQKQELDEISTNIRQAGVQYSRADEEQQQALS
SQMGF
| | Sequence Name: Rv3874 Full name: UniGene Number: N.A. Accession Number: NP_218391 Source organism: Tuberculosis (Mtb strain H37Rv) ( Mycobacterium tuberculosis H37Rv ) Full length size (aa): 100 NCBI information page: click here Full length sequence: maemktdaatlaqeagnferisgdlktqidqvestagslqgqwrgaagta
aqaavvrfqeaankqkqeldeistnirqagvqysradeeqqqalssqmgf
|