Ashe juniper ( Juniperus ashei )
Jun-a3

Western result: ++

GST GST-Jun-a3 (fragment)

N.A. kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: Jun-a3
CBI Antibody Core Code: A0385
"Lot" Number: 1 Position: 100(61-160)
% Identical Homology of Target to Mouse Protein: 32% (NP_766086.1| PTK2 protein tyrosine kinase 2 beta; protein tyrosine kinase 2 beta; cellular adhesion kinase beta; proline-rich tyrosine kinase 2; calcium-dependent tyrosine kinase; related adhesion focal tyrosine kinase)
Molecular Weight of fusion protein: N.A. KDa

Target sequence used to make this antibody:
LAAGTASARFWGRTGCTFDASGKGSCQTGDCGGQLSCTVS
GAVPATLAEYTQSDQDYYDVSLVDGFNIPLAINPTNAQCT
APACKADINAVCPSELKVDG

Sequence Name: Jun-a3
Full name: allergen Jun a 3
UniGene Number: N.A.
Accession Number: AF121776
Source organism: Ashe juniper ( Juniperus ashei )
Full length size (aa): 225
NCBI information page: click here

Sequence Notes: IgE epitope

Full length sequence:
MARVSELAFLLAATLAISLHMQEAGVVKFDIKNQCGYTVWAAGLPGGGKR
LDQGQTWTVNLAAGTASARFWGRTGCTFDASGKGSCQTGDCGGQLSCTVS
GAVPATLAEYTQSDQDYYDVSLVDGFNIPLAINPTNAQCTAPACKADINA
VCPSELKVDGGCNSACNVFKTDQYCCRNAYVDNCPATNYSKIFKNQCPQA
YSYAKDDTATFACASGTDYSIVFCP