human ( Homo sapiens )
ER alpha

Antibody Name/Abbreviation: ER alpha
CBI Antibody Core Code: A0031
"Lot" Number: 1 Position: To be posted
% Identical Homology of Target to Mouse Protein: 100% (NP_031982.1| estrogen receptor 1 (alpha); estrogen receptor alpha)
Molecular Weight of fusion protein: N.A. KDa

Target sequence used to make this antibody:
TGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPP
QLSPFLQPHGGGSGGSNDYASGYHYGVWSCEGCKAFFKRS
IQGHNDYMCPATNQCTIDKNRRKSCQ

Sequence Name: ER alpha
Full name:
UniGene Number: N.A.
Accession Number: P03372
Source organism: human ( Homo sapiens )
Full length size (aa): To be posted
NCBI information page: click here

Sequence Notes: ERa

Full length sequence: