human ( Homo sapiens )
Par6c

Western result: +

control Par6c (fragment)

29.2 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Antibody Name/Abbreviation: Par6c
CBI Antibody Core Code: A0885
"Lot" Number: 1 Position: 20(150-169)
% Identical Homology of Target to Mouse Protein: 100% (NP_062669.1| par-6 (partitioning defective 6,) homolog alpha; Tax interaction protein 40)
Molecular Weight of GST-fusion: 29.2 KDa

Target sequence used to make this antibody:
LPETHRRVRLHKHGSDRPLG

Sequence Name: Par6c
Full name: Homo sapiens PAR6C
UniGene Number: N.A.
Accession Number: AF252292
Source organism: human ( Homo sapiens )
Full length size (aa): 345
NCBI information page:

Full length sequence:
MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVH
QIPGLDVLLGYTDAHGDLLPLTNDDSLHRALASGPPPLRLLVQKREADSS
GLAFASNSLQRRKKGLLLRPVAPLRTRPPLLISLPQDFRQVSSVIDVDLL
PETHRRVRLHKHGSDRPLGFYIRDGMSVRVAPQGLERVPGIFISRLVRGG
LAESTGLLAVSDEILEVNGIEVAGKTLDQVTDMMVANSHNLIVTVKPANQ
RNNVVRGASGRLTGPPSAGPGPAEPDSDDDSSDLVIENRQPPSSNGLSQG
PPCWDLHPGCRHPGTRSSLPSLDDQEQASSGWGSRIRGDGSGFSL