human ( Homo sapiens )
TM4SF3

Western result: +

GST GST-TM4SF3 (fragment)

37.89 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: TM4SF3
CBI Antibody Core Code: A0851
"Lot" Number: 1 Position: 99(108-206)
% Identical Homology of Target to Mouse Protein: 57% (NP_666122.1| transmembrane 4 superfamily member 3)
Molecular Weight of fusion protein: 37.89 KDa

Target sequence used to make this antibody:
VFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQE
EFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGK
QVYKETCISFIKDFLAKNL

Sequence Name: TM4SF3
Full name: Transmembrane 4 superfamily, member 3 (Tumor-associated antigen CO-029)
UniGene Number: Hs.84072
Accession Number: NM_004616
Source organism: human ( Homo sapiens )
Full length size (aa): 237
NCBI information page:

Full length sequence:
MAGVSACIKYSMFTFNFLFWLCGILILALAIWVRVSNDSQAIFGSEDVGS
SSYVAVDILIAVGAIIMILGFLGCCGAIKESRCMLLLFFIGLLLILLLQV
ATGILGAVFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFK
CCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKD
FLAKNLIIVIGISFGLAVIEILGLVFSMVLYCQIGNK