human ( Homo sapiens )
SIAT4A

Western result: +

control SIAT4A-pep2 A0832 (fragment)

29.2 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Antibody Name/Abbreviation: SIAT4A-pep2
CBI Antibody Core Code: A0832
"Lot" Number: 1 Position: 20(96-115)
% Identical Homology of Target to Mouse Protein: 90% (NP_033203.1| sialyltransferase 4A (beta-galactoside alpha-2,3-sialytransferase); CMP-N-acetylneuraminate: [beta-galactosidase alpha-2,3] sialytransferase; sialyltransferase 4A (beta-galactosidase alpha-2,3-sialytransferase))
Molecular Weight of GST-fusion: 29.2 KDa

Target sequence used to make this antibody:
DTYRWWLRLQREKKPNNLND

Western result: +

GST GST-SIAT4A A0829 (fragment)

38 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: SIAT4A
CBI Antibody Core Code: A0829
"Lot" Number: 1 Position: 100(225-324)
% Identical Homology of Target to Mouse Protein: 89% (NP_033203.1| sialyltransferase 4A (beta-galactoside alpha-2,3-sialytransferase); CMP-N-acetylneuraminate: [beta-galactosidase alpha-2,3] sialytransferase; sialyltransferase 4A (beta-galactosidase alpha-2,3-sialytransferase))
Molecular Weight of fusion protein: 38 KDa

Target sequence used to make this antibody:
TISHTYIPVPAKIRVKQDKILIYHPAFIKYVFDNWLQGHG
RYPSTGILSVIFSMHVCDEVDLYGFGADSKGNWHHYWENN
PSAGAFRKTGVHDADFESNV

Western result: +

control SIAT4A-pep5 A0835 (fragment)

29.2 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Antibody Name/Abbreviation: SIAT4A-pep5
CBI Antibody Core Code: A0835
"Lot" Number: 1 Position: 20(290-309)
% Identical Homology of Target to Mouse Protein: 100% (NP_033203.1| sialyltransferase 4A (beta-galactoside alpha-2,3-sialytransferase); CMP-N-acetylneuraminate: [beta-galactosidase alpha-2,3] sialytransferase; sialyltransferase 4A (beta-galactosidase alpha-2,3-sialytransferase))
Molecular Weight of GST-fusion: 29.2 KDa

Target sequence used to make this antibody:
GADSKGNWHHYWENNPSAGA

Western result: +

control SIAT4A-pep3 A0833 (fragment)

29.2 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Antibody Name/Abbreviation: SIAT4A-pep3
CBI Antibody Core Code: A0833
"Lot" Number: 1 Position: 20(145-164)
% Identical Homology of Target to Mouse Protein: 90% (NP_033203.1| sialyltransferase 4A (beta-galactoside alpha-2,3-sialytransferase); CMP-N-acetylneuraminate: [beta-galactosidase alpha-2,3] sialytransferase; sialyltransferase 4A (beta-galactosidase alpha-2,3-sialytransferase))
Molecular Weight of GST-fusion: 29.2 KDa

Target sequence used to make this antibody:
VGNSGNLRESSYGPEIDSHD

Sequence Name: SIAT4A
Full name: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2, etc.
UniGene Number: Hs.301698
Accession Number: NM_003033
Source organism: human ( Homo sapiens )
Full length size (aa): 340
NCBI information page:

Sequence Notes: A0833 antigen: This antibody was generated from mice that were immunized with a mixed peptides from different regions of the antigen sequence. Serum was tested on individual peptide.

Full length sequence:
MVTLRKRTLKVLTFLVLFIFLTSFFLNYSHTMVATTWFPKQMVLELSENL
KRLIKHRPCTCTHCIGQRKLSAWFDERFNQTMQPLLTAQNALLEDDTYRW
WLRLQREKKPNNLNDTIKELFRVVPGNVDPMLEKRSVGCRRCAVVGNSGN
LRESSYGPEIDSHDFVLRMNKAPTAGFEADVGTKTTHHLVYPESFRELGD
NVSMILVPFKTIDLEWVVSAITTGTISHTYIPVPAKIRVKQDKILIYHPA
FIKYVFDNWLQGHGRYPSTGILSVIFSMHVCDEVDLYGFGADSKGNWHHY
WENNPSAGAFRKTGVHDADFESNVTATLASINKIRIFKGR