Return to CBI Antibody Core Home Page
  Return to human list
    Return to human ( Homo sapiens ) list


human ( Homo sapiens )
Stathmin 1


Antibody Name/Abbreviation: Stathmin 1
CBI Antibody Core Code: A0670

"Lot" Number: 1 Position: 20(130-149)
% Identical Homology of Target to Mouse Protein: 95% (NP_062615.1| stathmin 1; leukemia-associated gene; leukemia associated phosphoprotein p18; metablastin; oncoprotein18; prosolin)
Molecular Weight of GST-fusion: N.A. KDa

Target sequence used to make this antibody:
IEEVRKNKESKDPADETEAD






Sequence Name: Stathmin 1
Full name: stathmin 1; metablastin; prosolin; oncoprotein 18; phosphoprotein 19; stathmin; leukemia-associated phosphoprotein p18
UniGene Number: N.A.
Accession Number: NP_005554; gi:5031851
Source organism: human ( Homo sapiens )
Full length size (aa): 149
NCBI information page: click here

Full length sequence:
MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEI
QKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEK
LTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD





Questions? Click here for answers.


© Monday, February 16, 2009 by the CBI Antibody Core and the Center for Biomedical Inventions, University of Texas Southwestern Medical School.