human ( Homo sapiens )
CMT

Western result: +

GST GST-CMT A0170 (fragment)

N.A. kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: CMT
CBI Antibody Core Code: A0170
"Lot" Number: 1 Position: 100(185-284)
% Identical Homology of Target to Mouse Protein: 95% (XP_131821.3| isoprenylcysteine carboxyl methyltransferase)
Molecular Weight of fusion protein: N.A. KDa

Target sequence used to make this antibody:
FNHVVQNEKSDTHTLVTSGVYAWFRHPSYVGWFYWSIGTQ
VMLCNPICGVSYALTVWRFFRDRTEEEEISLIHFFGEEYL
EYKKRVPTGLPFIKGVKVDL

Western result: +

control CMT-pep2-test A0979 (fragment)

29.2 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Antibody Name/Abbreviation: CMT-pep2-test
CBI Antibody Core Code: A0979
"Lot" Number: 1 Position: 20 (180-199)
% Identical Homology of Target to Mouse Protein: 95% (XP_131821.3| isoprenylcysteine carboxyl methyltransferase)
Molecular Weight of GST-fusion: 29.2 KDa

Target sequence used to make this antibody:
TAGSNFNHVVQNEKSDTHTL

Sequence Name: CMT
Full name: Prenylcysteine carboxyl methyltransferase (PCCMT)
UniGene Number: N.A.
Accession Number: AF064084
Source organism: human ( Homo sapiens )
Full length size (aa): 284
NCBI information page: click here

Full length sequence:
MAGCAARAPPGSEARLSLATFLLGASVLALPLLTRAGLQGRTGLALYVAG
LNALLLLLYRPPRYQIAIRACFLGFVFGCGTLLSFSQSSWSHFGWYMCSL
SLFHYSEYLVTAVNNPKSLSLDSFLLNHSLEYTVAALSSWLEFTLENIFW
PELKQITWLSVTGLLMVVFGECLRKAAMFTAGSNFNHVVQNEKSDTHTLV
TSGVYAWFRHPSYVGWFYWSIGTQVMLCNPICGVSYALTVWRFFRDRTEE
EEISLIHFFGEEYLEYKKRVPTGLPFIKGVKVDL