human ( Homo sapiens )
VAM5

Western result: +

control VAM5 (fragment)

N.A. kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Antibody Name/Abbreviation: VAM5
CBI Antibody Core Code: A0544
"Lot" Number: 1 Position: 23(94-116)
% Identical Homology of Target to Mouse Protein: 0%
Molecular Weight of GST-fusion: N.A. KDa

Target sequence used to make this antibody:
PQSSDSSSAPRTQDAGIASGPGN

Sequence Name: VAM5
Full name: Vesicule-associated membrane protein 5 (VAMP-5) (Myobrevin) (HSPC191).
UniGene Number: Hs.369051
Accession Number: O95183
Source organism: human ( Homo sapiens )
Full length size (aa): 116
NCBI information page: click here

Sequence Notes: Q9P0T2

Full length sequence:
MAGIELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSST
FNKTTQNLAQKKCWENIRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSS
SAPRTQDAGIASGPGN