Return to CBI Antibody Core Home Page
  Return to human list
    Return to human ( Homo sapiens ) list


human ( Homo sapiens )
TNF alpha


Antibody Name/Abbreviation: TNF alpha
CBI Antibody Core Code: 1Ab062

"Lot" Number: 1 Position: To be posted
% Identical Homology of Target to Mouse Protein: N.A.
Molecular Weight of fusion protein: N.A. KDa

Target sequence used to make this antibody:
To be posted






Sequence Name: TNF alpha
Full name:
UniGene Number: N.A.
Accession Number: P01375
Source organism: human ( Homo sapiens )
Full length size (aa): To be posted
NCBI information page: click here

Full length sequence:
mstesmirdvelaeealpkktggpqgsrrclflslfsflivagattlfcl
lhfgvigpqreefprdlslisplaqavrsssrtpsdkpvahvvanpqaeg
qlqwlnrranallangvelrdnqlvvpseglyliysqvlfkgqgcpsthv
llthtisriavsyqtkvnllsaikspcqretpegaeakpwyepiylggvf
qlekgdrlsaeinrpdyldfaesgqvyfgiial





Questions? Click here for answers.


© Monday, February 16, 2009 by the CBI Antibody Core and the Center for Biomedical Inventions, University of Texas Southwestern Medical School.