human ( Homo sapiens )
ASF1b

Western result: +

control ASF1b (fragment)

32.2 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Antibody Name/Abbreviation: ASF1b
CBI Antibody Core Code: A0160
"Lot" Number: 1 Position: 20(148-167)
% Identical Homology of Target to Mouse Protein: 85% (NP_077146.1| ASF1 anti-silencing function 1 homolog B)
Molecular Weight of GST-fusion: 32.2 KDa

Target sequence used to make this antibody:
RFHINWDNNMDRLEAIETQD

Sequence Name: ASF1b
Full name:
UniGene Number: N.A.
Accession Number: NP_060624
Source organism: human ( Homo sapiens )
Full length size (aa): 202
NCBI information page: click here

Full length sequence:
MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAES
EEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCT
YHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFH
INWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMD
CI