| Western result: + | | | | | | | | The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used. | | Antibody Name/Abbreviation: ASF1a CBI Antibody Core Code: A0159 "Lot" Number: 2 Position: 20(148-167) % Identical Homology of Target to Mouse Protein: 100% (NP_079817.1| ASF1 anti-silencing function 1 homolog A) Molecular Weight of GST-fusion: 32.2 KDa Target sequence used to make this antibody: RFHINWEDNTEKLEDAESSN
| | Sequence Name: ASF1a Full name: UniGene Number: N.A. Accession Number: NP_054753 Source organism: human ( Homo sapiens ) Full length size (aa): 204 NCBI information page: click here Full length sequence: MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAES
EEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCT
YRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFH
INWEDNTEKLEDAESSNPNLQSLLSTDALPSASKGWSTSENSLNVMLESH
MDCM
|