Return to CBI Antibody Core Home Page
  Return to human list
    Return to human ( Homo sapiens ) list


human ( Homo sapiens )
SOH1 (CGI-125)


Antibody Name/Abbreviation: SOH1 (CGI-125)
CBI Antibody Core Code: A0573

"Lot" Number: 1 Position: 20(54-73)
% Identical Homology of Target to Mouse Protein: 95% (NP_080344.1| RIKEN cDNA 3110004H13)
Molecular Weight of GST-fusion: N.A. KDa

Target sequence used to make this antibody:
YLLYWKDPEYAKYLKYPQCL






Sequence Name: SOH1 (CGI-125)
Full name: CGI-125 protein
UniGene Number: N.A.
Accession Number: NP_057144
Source organism: human ( Homo sapiens )
Full length size (aa): 131
NCBI information page: click here

Full length sequence:
MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVN
YLKYLLYWKDPEYAKYLKYPQCLHMLELLQYEHFRKELVNAQCAKFIDEQ
QILHWQHYSRKRMRLQQALAEQQQQNNTSGK





Questions? Click here for answers.


© Monday, February 16, 2009 by the CBI Antibody Core and the Center for Biomedical Inventions, University of Texas Southwestern Medical School.