human ( Homo sapiens )
PLVAP (Pv-1)

Western result: +

control PLVAP-pep (Pv-1) A0649 (fragment)

N.A. kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Antibody Name/Abbreviation: PLVAP-pep (Pv-1)
CBI Antibody Core Code: A0649
"Lot" Number: 1 Position: 19(412-430)
% Identical Homology of Target to Mouse Protein: 89% (NP_115774.1| plasmalemma vesicle associated protein)
Molecular Weight of GST-fusion: N.A. KDa

Target sequence used to make this antibody:
PIDPASLEEFKRKILESQR

Western result: +

GST GST-PLVAP (Pv-1) A0648 (fragment)

38 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: PLVAP (Pv-1)
CBI Antibody Core Code: A0648
"Lot" Number: 2 Position: 100(331-430)
% Identical Homology of Target to Mouse Protein: 59% (NP_115774.1| plasmalemma vesicle associated protein)
Molecular Weight of fusion protein: 38 KDa

Target sequence used to make this antibody:
AREAKLQAECSRQTQLALEEKAVLRKERDNLAKELEEKKR
EAEQLRMELAIRNSALDTCIKTKSQPMMPVSRPMGPVPNP
QPIDPASLEEFKRKILESQR

Other western:
Code: A0648
Lot: 1

Western result: +

GST GST-PLVAP (Pv-1) (fragment)

38 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Sequence Name: PLVAP (Pv-1)
Full name: plasmalemma vesicle associated protein
UniGene Number: N.A.
Accession Number: NP_112600
Source organism: human ( Homo sapiens )
Full length size (aa): 442
NCBI information page: click here

Full length sequence:
MGLAMEHGGSYARAGGSSRGCWYYLRYFFLFVSLIQFLIILGLVLFMVYG
NVHVSTESNLQATERRAEGLYSQLLGLTASQSNLTKELNFTTRAKDAIMQ
MWLNARRDLDRINASFRQCQGDRVIYTNNQRYMAAIILSEKQCRDQFKDM
NKSCDALLFMLNQKVKTLEVEIAKEKTICTKDKESVLLNKRVAEEQLVEC
VKTRELQHQERQLAKEQLQKVQALCLPLDKDKFEMDLRNLWRDSIIPRSL
DNLGYNLYHPLGSELASIRRACDHMPSLMSSKVEELARSLRADIERVARE
NSDLQRQKLEAQQGLRASQEAKQKVEKEAQAREAKLQAECSRQTQLALEE
KAVLRKERDNLAKELEEKKREAEQLRMELAIRNSALDTCIKTKSQPMMPV
SRPMGPVPNPQPIDPASLEEFKRKILESQRPPAGIPVAPSSG