human ( Homo sapiens )
phospholamban

Antibody Name/Abbreviation: phospholamban
CBI Antibody Core Code: 1Ab046
"Lot" Number: 1 Position: To be posted
% Identical Homology of Target to Mouse Protein: N.A.
Molecular Weight of fusion protein: N.A. KDa

Target sequence used to make this antibody:
To be posted

Sequence Name: phospholamban
Full name:
UniGene Number: N.A.
Accession Number: M63603
Source organism: human ( Homo sapiens )
Full length size (aa): To be posted
NCBI information page: click here

Full length sequence:
MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVM
LL