| Antibody Name/Abbreviation: phospholamban CBI Antibody Core Code: 1Ab046 "Lot" Number: 1 Position: To be posted % Identical Homology of Target to Mouse Protein: N.A. Molecular Weight of fusion protein: N.A. KDa Target sequence used to make this antibody: To be posted
| | Sequence Name: phospholamban Full name: UniGene Number: N.A. Accession Number: M63603 Source organism: human ( Homo sapiens ) Full length size (aa): To be posted NCBI information page: click here Full length sequence: MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVM
LL
|