human ( Homo sapiens )
NRSF

Antibody Name/Abbreviation: NRSF-M
CBI Antibody Core Code: A0372
"Lot" Number: 3 Position: 100(301-400)
% Identical Homology of Target to Mouse Protein: 95% (NP_035393.1| RE1-silencing transcription factor)
Molecular Weight of fusion protein: N.A. KDa

Target sequence used to make this antibody:
DRCGYNTNRYDHYTAHLKHHTRAGDNERVYKCIICTYTTV
SEYHWRKHLRNHFPRKVYTCGKCNYFSDRKNNYVQHVRTH
TGERPYKCELCPYSSSQKTH

Other western:
Code: A0372
Lot: 1

Western result: +++

GST GST-NRSF-M (fragment)

N.A. kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: NRSF-N
CBI Antibody Core Code: A0371
"Lot" Number: 2 Position: 100 (1-100)
% Identical Homology of Target to Mouse Protein: 34% (NP_898841.1| ataxin 2 related protein)
Molecular Weight of fusion protein: N.A. KDa

Target sequence used to make this antibody:
NSGAPDPGGGCGSRDGRARPGGLSTLCSPTPGPSWSTTAP
APNFTTLPHLSPETPATKKSSRRRSGDSGSPAPPHRGRPN
TVMATQVMGQSSGGGGLFTS

Other western:
Code: A0371
Lot: 1

Western result: +++

GST GST-NRSF-N (fragment)

N.A. kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: NRSF-M
CBI Antibody Core Code: A0372
"Lot" Number: 3 Position: 100(301-400)
% Identical Homology of Target to Mouse Protein: 95% (NP_035393.1| RE1-silencing transcription factor)
Molecular Weight of fusion protein: N.A. KDa

Target sequence used to make this antibody:
DRCGYNTNRYDHYTAHLKHHTRAGDNERVYKCIICTYTTV
SEYHWRKHLRNHFPRKVYTCGKCNYFSDRKNNYVQHVRTH
TGERPYKCELCPYSSSQKTH

Other western:
Code: A0372
Lot: 1

Western result: +++

GST GST-NRSF-M (fragment)

N.A. kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Sequence Name: NRSF
Full name: neuron-restrictive silencer factor (NRSF)
UniGene Number: N.A.
Accession Number: U13879
Source organism: human ( Homo sapiens )
Full length size (aa): 681
NCBI information page: click here

Full length sequence:
NSGAPDPGGGCGSRDGRARPGGLSTLCSPTPGPSWSTTAPAPNFTTLPHL
SPETPATKKSSRRRSGDSGSPAPPHRGRPNTVMATQVMGQSSGGGGLFTS
SGNIGMALPNDMYDLHDLSKAELAAPQLIMLANVALTGEVNGSCCDYLVG
EERQMAELMPVGDNNFSDSEEGEGLEESADIKGEPHGLENMELRSLELSV
VEPQPVFEASGAPDIYSSNKDLPPETPGAEDKGKSSKTKPFRCKPCQYEA
ESEEQFVHHIRVHSAKKFFVEESAEKQAKARESGSSTAEEGDFSKGPIRC
DRCGYNTNRYDHYTAHLKHHTRAGDNERVYKCIICTYTTVSEYHWRKHLR
NHFPRKVYTCGKCNYFSDRKNNYVQHVRTHTGERPYKCELCPYSSSQKTH
LTRHMRTHSGEKPFKCDQCSYVASNQHEVTRHARQVHNGPKPLNCPHCDY
KTADRSNFKKHVELHVNPRQFNCPVCDYAASKKCNLQYHFKSKHPTCPNK
TMDVSKVKLKKTKKREADLPDNITNEKTEIEQTKIKGDVAGKKNEKSVKA
EKRDVSKEKKPSNNVSVIQVTTRTRKSVTEVKEMDVHTGSNSEKFSKTKK
SKRKLEVDSHSLHGPVNDEESSTKKKKKVESKSKNNSQEVPKGDSKVEEN
KKQNTCMKKSTKKKTLKNKSSKKSSKPSRNS