human ( Homo sapiens )
MCIP1-alt exon (DSCR1)

Western result: +

GST GST-MCIP1-alt exon (DSCR1) (fragment)

N.A. kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: MCIP1-alt exon (DSCR1)
CBI Antibody Core Code: A0042
"Lot" Number: 2 Position: Full Length
% Identical Homology of Target to Mouse Protein: 85% (NP_062339.2| calcipressin 1; myocyte-enriched calcineurin interactin protein 1; calcineurin inhibitor)
Molecular Weight of fusion protein: N.A. KDa

Target sequence used to make this antibody:
HKTEFLGKEMKLYFAQTLHIGSSHLAPPNPDKQFLISPPA
SPPVGWKQVEDATPVINYDLLYAISKLGPGEKYELHAATD
TTPSVVVHVCESDQEKEEEEEMERMRRPKPKIIQTRRPEY
TPIHLS

Sequence Name: MCIP1-alt exon (DSCR1)
Full name:
UniGene Number: N.A.
Accession Number: U85267
Source organism: human ( Homo sapiens )
Full length size (aa): To be posted
NCBI information page:

Full length sequence: