Return to CBI Antibody Core Home Page
  Return to human list
    Return to human ( Homo sapiens ) list


human ( Homo sapiens )
Twist 2


Antibody Name/Abbreviation: Twist 2
CBI Antibody Core Code: A1464

"Lot" Number: 1 Position: 58 (1-58)
% Identical Homology of Target to Mouse Protein: 100% (NP_031881.1| twist homolog 2; dermis expressed 1)
Molecular Weight of fusion protein: 20.38 KDa

Target sequence used to make this antibody:
MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSS
EDGSPTPGKRGKKGSPSA






Sequence Name: Twist 2
Full name: Homo sapiens Twist homolog 2
UniGene Number: N.A.
Accession Number: NM_057179
Source organism: human ( Homo sapiens )
Full length size (aa): 160
NCBI information page:

Full length sequence:
MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKR
GKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDK
LSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHERLSYAFSVWRM
EGAWSMSASH





Questions? Click here for answers.


© Monday, February 16, 2009 by the CBI Antibody Core and the Center for Biomedical Inventions, University of Texas Southwestern Medical School.