| Antibody Name/Abbreviation: LBP-1c CBI Antibody Core Code: A1446 "Lot" Number: 2 Position: 40 (120-159) % Identical Homology of Target to Mouse Protein: 100% (NP_258437.1| transcription factor CP2) Molecular Weight of fusion protein: N.A. KDa Target sequence used to make this antibody: FRVVFHDRRLQYTEHQQLEGWRWNRPGDRILDIDIPMSVG
| | Sequence Name: LBP-1c Full name: UniGene Number: N.A. Accession Number: NP_005644 Source organism: human ( Homo sapiens ) Full length size (aa): 164 NCBI information page: Full length sequence: mawalklpladeviesglvqdfdaslsgigqelgagaysmsdvlalpifk
qeesslppdnenkilpfqyvlcaatspavklhdetltylnqgqsyeirml
dnrklgelpeingklvksifrvvfhdrrlqytehqqlegwrwnrpgdril
didipmsvgiidpr
|