Links to multiple antibodies on this page for MGC14832: MGC14832 MGC14832 Antibody Name/Abbreviation: MGC14832 CBI Antibody Core Code: A1439 "Lot" Number: 1 Position: 115 (1-115) % Identical Homology of Target to Mouse Protein: 84% (NP_079835.1| RIKEN cDNA 1810046J19) Molecular Weight of fusion protein: 26.65 KDa Target sequence used to make this antibody: msgepgqtsvapppeevepgsgvrivveycepcgfeatyl
elasavkeqypgieiesrlggtgafeieingqlvfsklen
ggfpyekdlieairrasngetlekitnsrppcvil
Antibody Name/Abbreviation: MGC14832 CBI Antibody Core Code: A1439rat "Lot" Number: 1 Position: To be posted % Identical Homology of Target to Mouse Protein: N.A. Molecular Weight of fusion protein: N.A. KDa Target sequence used to make this antibody: To be posted
| | Sequence Name: MGC14832 Full name: Chromosome 17 open reading frame 37 UniGene Number: N.A. Accession Number: AAH06006 Source organism: human ( Homo sapiens ) Full length size (aa): 115 NCBI information page: click here Full length sequence: msgepgqtsvapppeevepgsgvrivveycepcgfeatylelasavkeqy
pgieiesrlggtgafeieingqlvfsklenggfpyekdlieairrasnge
tlekitnsrppcvil
|