| Western result: + | | | | | | | | The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST. | | Antibody Name/Abbreviation: IVa2 CBI Antibody Core Code: A0782 "Lot" Number: 3 Position: 100(5-104) % Identical Homology of Target to Mouse Protein: 31% (NP_067370.2| hypoxia up-regulated 1; 170 kDa glucose regulated protein GRP170 precursor; calcium binding protein, 140 kDa; 150-kDa oxygen regulated protein; 140 kDa; calcium binding protein 140) Molecular Weight of fusion protein: 38 KDa Target sequence used to make this antibody: GRRPAALQHQQDQPQAHPGQRAARSAPLHRDPDYADEDPA
PVERHDPGPSGRAPTTAVQRKPPQPAKRGDMLDRDAVEQV
TELWDRLELLGQTLKSMPTA
| | Sequence Name: IVa2 Full name: unnamed protein product UniGene Number: N.A. Accession Number: CAB40667 Source organism: human ( Homo sapiens ) Full length size (aa): 449 NCBI information page: click here Full length sequence: METRGRRPAALQHQQDQPQAHPGQRAARSAPLHRDPDYADEDPAPVERHD
PGPSGRAPTTAVQRKPPQPAKRGDMLDRDAVEQVTELWDRLELLGQTLKS
MPTADGLKPLKNFASLQELLSLGGERLLADLVRENMRVRDMLNEVAPLLR
DDGSCSSLNYQLHPVIGVIYGPTGCGKSQLLRNLLSSQLISPTPETVFFI
APQVDMIPPSELKAWEMQICEGNYAPGPDGTIIPQSGTLRPRFVKMAYDD
LILEHNYDVSDPRNIFAQAAARGPIAIIMDECMENLGGHKGVSKFFHAFP
SKLHDKFPKCTGYTVLVVLHNMNPRRDMAGNIANLKIQSKMHLISPRMHP
SQLNRFVNTYTKGLPLAISLLLKDIFRHHAQRSCYDWIIYNTTPQHEALQ
WCYLHPRDGLMPMYLNIQSHLYHVLEKIHRTLNDRDRWSRAYRARKTPK
|