Links to multiple antibodies on this page for SCP1: SCP1 SCP1 Antibody Name/Abbreviation: SCP1 CBI Antibody Core Code: A1418 "Lot" Number: 1 Position: 72 (1-72) % Identical Homology of Target to Mouse Protein: 97% (NP_694728.1| CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 1; nuclear LIM interactor-interacting factor 3; NLI-interacting factor 3; golli-interacting protein; nuclear LIM interactor-interacting factor) Molecular Weight of fusion protein: 21.92 KDa Target sequence used to make this antibody: mdssavitqiskeeargplrgkgdqksaasqkprsrgilh
slfccvcrddgealpahsgapllveengaipk
Antibody Name/Abbreviation: SCP1 CBI Antibody Core Code: A1419 "Lot" Number: 1 Position: 100 (126-224)) % Identical Homology of Target to Mouse Protein: 100% (NP_694728.1| CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 1; nuclear LIM interactor-interacting factor 3; NLI-interacting factor 3; golli-interacting protein; nuclear LIM interactor-interacting factor) Molecular Weight of fusion protein: 25 KDa Target sequence used to make this antibody: VADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRR
VLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFF
EQLSRVDDVYSVLRQPRPGS
| | Sequence Name: SCP1 Full name: UniGene Number: N.A. Accession Number: AY_279529 Source organism: human ( Homo sapiens ) Full length size (aa): 261 NCBI information page: Full length sequence: mdssavitqiskeeargplrgkgdqksaasqkprsrgilhslfccvcrdd
gealpahsgapllveengaipkqtpvqyllpeakaqdsdkicvvidldet
lvhssfkpvnnadfiipveidgvvhqvyvlkrphvdeflqrmgelfecvl
ftaslakyadpvadlldkwgafrarlfrescvfhrgnyvkdlsrlgrdlr
rvlildnspasyvfhpdnavpvaswfdnmsdtelhdllpffeqlsrvddv
ysvlrqprpgs
|