human ( Homo sapiens )
IL8-FL

Western result: ++

GST GST-interleukin 8 1Ab032 (fragment)

N.A. kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: interleukin 8
CBI Antibody Core Code: 1Ab032
"Lot" Number: 1 Position: To be posted
% Identical Homology of Target to Mouse Protein: N.A.
Molecular Weight of fusion protein: N.A. KDa

Target sequence used to make this antibody:
To be posted

Western result: +

GST GST-IL8-FL(test) A0815 (fragment)

37.89 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: IL8-FL(test)
CBI Antibody Core Code: A0815
"Lot" Number: 2 Position: 99(1-99)
% Identical Homology of Target to Mouse Protein: 53% (NP_032202.1| chemokine (C-X-C motif) ligand 1; GRO1 oncogene)
Molecular Weight of fusion protein: 37.89 KDa

Target sequence used to make this antibody:
MTSKLAVALLAAFLISAALCEGAVLPRSAKELRCQCIKTY
SKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDP
KENWVQRVVEKFLKRAENS

Other western:
Code: A0815
Lot: 1

Western result: +

GST GST-IL8-FL(test) (fragment)

37.89 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: IL8-fuse-linker(test)
CBI Antibody Core Code: A0810
"Lot" Number: 1 Position: 56(fuse with linker 28-48|56-64|70-85)
% Identical Homology of Target to Mouse Protein: 42% (NP_033166.1| chemokine (C-X-C motif) ligand 2; small inducible cytokine subfamily, member 2)
Molecular Weight of fusion protein: 20.16 KDa

Target sequence used to make this antibody:
SAKELRCQCIKTYSKPFHPKFGGGGSESGPHCANTGGGGS
LSDGRELCLDPKENWV

Antibody Name/Abbreviation: IL8-fuse-NoLinker(test)
CBI Antibody Core Code: A0811
"Lot" Number: 1 Position: 46(fuseNoLinker 28-48|56-64|70-85)
% Identical Homology of Target to Mouse Protein: 42% (NP_033166.1| chemokine (C-X-C motif) ligand 2; small inducible cytokine subfamily, member 2)
Molecular Weight of fusion protein: 32.06 KDa

Target sequence used to make this antibody:
SAKELRCQCIKTYSKPFHPKFESGPHCANTLSDGRELCLD
PKENWV

Antibody Name/Abbreviation: IL8-pepA(test)
CBI Antibody Core Code: A0812
"Lot" Number: 1 Position: 21(28-48)
% Identical Homology of Target to Mouse Protein: 81% (NP_033166.1| chemokine (C-X-C motif) ligand 2; small inducible cytokine subfamily, member 2)
Molecular Weight of GST-fusion: N.A. KDa

Target sequence used to make this antibody:
SAKELRCQCIKTYSKPFHPKF

Antibody Name/Abbreviation: IL8-pepB(test)
CBI Antibody Core Code: A0813
"Lot" Number: 1 Position: 9(56-64)
% Identical Homology of Target to Mouse Protein: 0%
Molecular Weight of GST-fusion: N.A. KDa

Target sequence used to make this antibody:
ESGPHCANT

Antibody Name/Abbreviation: IL8-pepC(test)
CBI Antibody Core Code: A0814
"Lot" Number: 1 Position: 16(70-85)
% Identical Homology of Target to Mouse Protein: 61% (NP_035460.1| small chemokine (C-C motif) ligand 11; small inducible cytokine A11)
Molecular Weight of GST-fusion: N.A. KDa

Target sequence used to make this antibody:
LSDGRELCLDPKENWV

Sequence Name: IL8-FL
Full name: interleukin 8
UniGene Number: N.A.
Accession Number: M28130
Source organism: human ( Homo sapiens )
Full length size (aa): 99
NCBI information page: click here

Full length sequence:
MTSKLAVALLAAFLISAALCEGAVLPRSAKELRCQCIKTYSKPFHPKFIK
ELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS