| Western result: ++ | | GST
 | GST-interleukin 3 (fragment)
 | | | | | | The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST. | | Antibody Name/Abbreviation: interleukin 3 CBI Antibody Core Code: 1Ab029 "Lot" Number: 1 Position: To be posted % Identical Homology of Target to Mouse Protein: N.A. Molecular Weight of fusion protein: N.A. KDa Target sequence used to make this antibody: To be posted
| | Sequence Name: interleukin 3 Full name: UniGene Number: N.A. Accession Number: M17115 Source organism: human ( Homo sapiens ) Full length size (aa): To be posted NCBI information page: click here Full length sequence: MSRLPVLLLLQLLVRPGLQAPMTQTTPLKTSWVNCSNMIDEIITHLKQPP
LPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNL
LPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLA
IF
|