| Antibody Name/Abbreviation: HnRNP C1/C2 CBI Antibody Core Code: A0567 "Lot" Number: 2 Position: 100(206-307) % Identical Homology of Target to Mouse Protein: 37% (NP_058580.1| heterogeneous nuclear ribonucleoprotein C; heterogeneous nuclear ribonucleoprotein C1; heterogeneous nuclear ribonucleoprotein C2; hnRNP C1; hnRNP C2) Molecular Weight of fusion protein: N.A. KDa Target sequence used to make this antibody: VDSLLENLEKMEKEQSKQAVEMKNDKSEEEQSSSSVKKDE
TNVKMESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDD
EKEAEEGEDDRDSANGEDDS
Other western: Code: A0567 Lot: 1 Western result: ++ | | GST
 | GST-HnRNP C1/C2 (fragment)
 | | | | | | The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST. | |
| | Sequence Name: HnRNP C1/C2 Full name: Heterogeneous nuclear ribonucleoproteins C1/C2 UniGene Number: N.A. Accession Number: P07910 Source organism: human ( Homo sapiens ) Full length size (aa): 306 NCBI information page: click here Full length sequence: MASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHK
GFAFVQYVNERNARAAVAGEDGRMIAGQVLDINLAAEPKVNRGKAGVKRS
AAEMYGSVTEHPSPSPLLSSSFDLDYDFQRDYYDRMYSYPARVPPPPPIA
RAVVPSKRQRVSGNTSRRGKSGFNSKSGQRGSSKSGKLKGDDLQAIKKEL
TQIKQKVDSLLENLEKMEKEQSKQAVEMKNDKSEEEQSSSSVKKDETNVK
MESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSA
NGEDDS
|