Return to CBI Antibody Core Home Page
  Return to human list
    Return to human ( Homo sapiens ) list


human ( Homo sapiens )
hADA2a (long isoform)



Western result: +
GST
GST-hADA2a (long isoform)
(fragment)

22.14 kDa (recombinant)
The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: hADA2a (long isoform)
CBI Antibody Core Code: A1180

"Lot" Number: 1 Position: 74 (296-369)
% Identical Homology of Target to Mouse Protein: 95% (NP_766150.1| transcriptional adaptor 2 (ADA2 homolog, yeast)-like)
Molecular Weight of fusion protein: 22.14 KDa

Target sequence used to make this antibody:
NFCSARTYDHLKKTREEERLKRTMLSEVLQYIQDSSACQQ
WLRRQAGIDSGLSPSIPMASNSGRRSAPPLNLTG






Sequence Name: hADA2a (long isoform)
Full name:
UniGene Number: N.A.
Accession Number: N.A.
Source organism: human ( Homo sapiens )
Full length size (aa): 443
NCBI information page:

Full length sequence:
MDRLGSFSNDPSDKPPCRGCSSYLMEPYIKCAECGPPPFFLCLQCFTRGF
EYKKHQSDHTYEIMTSDFPVLDPSWTAQEEMALLEAVMDCGFGNWQDVAN
QMCTKTKEECEKHYMKHFINNPLFASTLLNLKQAEEAKTADTAIPFHSTD
DPPRPTFDSLLSRDMAGYMPARADFIEEFDNYAEWDLRDIDFVEDDSDIL
HALKMAVVDIYHSRLKERQRRKKIIRDHGLINLRKFQLMERRYPKEVQDL
YETMRRFARIVGPVEHDKFIESHALEFELRREIKRLQEYRTAGITNFCSA
RTYDHLKKTREEERLKRTMLSEVLQYIQDSSACQQWLRRQAGIDSGLSPS
IPMASNSGRRSAPPLNLTGLPGTEKLNEKEKELCQMVRLVPGAYLEYKSA
LLNECNKQGGLRLAQARALIKIDVNKTRKIYDFLIREGYITKG





Questions? Click here for answers.


© Monday, February 16, 2009 by the CBI Antibody Core and the Center for Biomedical Inventions, University of Texas Southwestern Medical School.