human ( Homo sapiens )
PDIR (5803121)

Western result: +

GST GST-PDIR (5803121) A1160a (fragment)

25 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: PDIR (5803121)
CBI Antibody Core Code: A1160a
"Lot" Number: 1 Position: 100 (196-295)
% Identical Homology of Target to Mouse Protein: 84% (NP_082571.1| protein disulfide isomerase-related)
Molecular Weight of fusion protein: 25 KDa

Target sequence used to make this antibody:
ATQLRGHAVLAGMNVYSSEFENIKEEYSVRGFPTICYFEK
GRFLFQYDNYGSTAEDIVEWLKNPQPPQPQVPETPWADEG
GSVYHLTDEDFDQFVKEHSS

Western result: +

control PDIR (5803121) A1160b (fragment)

32.2 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Antibody Name/Abbreviation: PDIR (5803121)
CBI Antibody Core Code: A1160b
"Lot" Number: 1 Position: 20 (254-273)
% Identical Homology of Target to Mouse Protein: 55% (NP_082571.1| protein disulfide isomerase-related)
Molecular Weight of GST-fusion: 32.2 KDa

Target sequence used to make this antibody:
EWLKNPQPPQPQVPETPWAD

Sequence Name: PDIR (5803121)
Full name: PDIR
UniGene Number: N.A.
Accession Number: 5803121
Source organism: human ( Homo sapiens )
Full length size (aa): 519
NCBI information page:

Full length sequence:
maragpawlllaiwvvlpswlssakvsslierisdpkdlkkllrtrnnvl
vlysksevaaenhlrllstvaqavkgqgticwvdcgdaesrklckkmkvd
lspkdkkvelfhyqdgafhteynravtfksivaflkdpkgpplweedpga
kdvvhldsekdfrrllkkeekpllimfyapwcsmckrmmphfqkaatqlr
ghavlagmnvyssefenikeeysvrgfpticyfekgrflfqydnygstae
divewlknpqppqpqvpetpwadeggsvyhltdedfdqfvkehssvlvmf
hapwcghckkmkpefekaaealhgeadssgvlaavdatvnkalaerfhis
efptlkyfkngekyavpvlrtkkkflewmqnpeappppeptweeqqtsvl
hlvgdnfretlkkkkhtlvmfyapwcphckkviphftatadafkddrkia
caavdcvkdknqdlcqqeavkgyptfhyyhygkfaekydsdrtelgftny
iralregdherlgkkkeel