human ( Homo sapiens )
dysbindin

Western result: +

control HPS-7 (dysbindin) A1130b (fragment)

32.2 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Antibody Name/Abbreviation: HPS-7 (dysbindin)
CBI Antibody Core Code: A1130b
"Lot" Number: 1 Position: 20 (148-167)
% Identical Homology of Target to Mouse Protein: 70% (NP_080048.2| dystrobrevin binding protein 1; sandy)
Molecular Weight of GST-fusion: 32.2 KDa

Target sequence used to make this antibody:
KHMQSQQLENYKKNKRKELE

Western result: +

GST GST-HPS-7 (dysbindin) A1130a (fragment)

25 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: HPS-7 (dysbindin)
CBI Antibody Core Code: A1130a
"Lot" Number: 1 Position: 100 (135-234)
% Identical Homology of Target to Mouse Protein: 87% (NP_080048.2| dystrobrevin binding protein 1; sandy)
Molecular Weight of fusion protein: 25 KDa

Target sequence used to make this antibody:
LEDLCGQCELERCKHMQSQQLENYKKNKRKELETFKAELD
AEHAQKVLEMEHTQQMKLKERQKFFEEAFQQDMEQYLSTG
YLQIAERREPIGSMSSMEVN

Sequence Name: dysbindin
Full name: dystrobrevin binding protein 1 isoform a; dysbindin
UniGene Number: N.A.
Accession Number: NP_115498.2
Source organism: human ( Homo sapiens )
Full length size (aa): 351
NCBI information page: click here

Full length sequence:
mletlrerllsvqqdftsglktlsdksreakvkskprtvpflpkysagle
llsryedtwaalhrrakdcasagelvdsevvmlsahwekkktslvelqeq
lqqlpaliadlesmtanlthleasfeevennllhledlcgqcelerckhm
qsqqlenykknkrkeletfkaeldaehaqkvlemehtqqmklkerqkffe
eafqqdmeqylstgylqiaerrepigsmssmevnvdmleqmdlmdisdqe
aldvflnsggeentvlspalgpesstcqneitlqvpnpselrakppssss
tctdsatrdiseggespvvqsdeeevqvdtalatshtdreatpdggedsd
s