Links to multiple antibodies on this page for PPP2R5C: PPP2R5C PPP2R5C Western result: + | | control
 | PPP2R5C A1121b (fragment)
 | | | | | | The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used. | | Antibody Name/Abbreviation: PPP2R5C CBI Antibody Core Code: A1121b "Lot" Number: 1 Position: 10 (481-490) % Identical Homology of Target to Mouse Protein: 0% Molecular Weight of GST-fusion: 31.1 KDa Target sequence used to make this antibody: qaqkdpkkdr
Antibody Name/Abbreviation: PPP2R5C CBI Antibody Core Code: A1121a "Lot" Number: 1 Position: FL cDNA % Identical Homology of Target to Mouse Protein: 90% (NP_036153.1| gamma isoform of regulatory subunit B56, protein phosphatase 2A; Band 8A) Molecular Weight of fusion protein: 31.76 KDa Target sequence used to make this antibody: Full length cDNA
| | Sequence Name: PPP2R5C Full name: UniGene Number: N.A. Accession Number: U37352 Source organism: human ( Homo sapiens ) Full length size (aa): 524 NCBI information page: Full length sequence: mltcnkagsrmvvdaansngpfqpvvllhirdvppadqeklfiqklrqcc
vlfdfvsdplsdlkwkevkraalsemveyithnrnvitepiypevvhmfa
vnmfrtlppssnptgaefdpeedeptleaawphlqlvyefflrflespdf
qpniakkyidqkfvlqllelfdsedprerdflkttlhriygkflglrayi
rkqinnifyrfiyetehhngiaelleilgsiingfalplkeehkifllkv
llplhkvkslsvyhpqlaycvvqflekdstltepvvmallkywpkthspk
evmflneleeildviepsefvkimeplfrqlakcvssphfqvaeralyyw
nneyimslisdnaakilpimfpslyrnskthwnktihgliynalklfmem
nqklfddctqqfkaeklkeklkmkereeawvkienlakanpqytvysqas
tmsipvametdgplfedvqmlrktvkdeahqaqkdpkkdrplarrkselp
qdphtkkaleahcradelasqdgr
|