human ( Homo sapiens )
or1d2

Western result: +

control or1d2 A1022b (fragment)

32.2 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Antibody Name/Abbreviation: or1d2
CBI Antibody Core Code: A1022b
"Lot" Number: 1 Position: 20 (290-309)
% Identical Homology of Target to Mouse Protein: 57% (NP_666393.1| olfactory receptor 284; GA_x6K02T2NBG7-5395976-5396893; olfactory receptor MOR160-4)
Molecular Weight of GST-fusion: 32.2 KDa

Target sequence used to make this antibody:
SLRNKDMHGALGRLLDKHFK

Antibody Name/Abbreviation: or1d2
CBI Antibody Core Code: A1022a
"Lot" Number: 1 Position: 28 (2-28)
% Identical Homology of Target to Mouse Protein: 62% (NP_666450.1| olfactory receptor 374; GA_x6K02T2NUPS-241490-242431; olfactory receptor MOR130-1)
Molecular Weight of GST-fusion: 32.97 KDa

Target sequence used to make this antibody:
DGGNQSEGSEFLLLGMSESPEQQQILF

Sequence Name: or1d2
Full name:
UniGene Number: N.A.
Accession Number: NP_002539
Source organism: human ( Homo sapiens )
Full length size (aa): 312
NCBI information page:

Full length sequence:
mdggnqsegseflllgmsespeqqqilfwmflsmylvtvvgnvliilais
sdsrlhtpvyfflanlsftdlffvtntipkmlvnlqshnkaisyagcltq
lyflvslvaldnlilavmaydryvaiccplhyttamspklcilllslcwv
lsvlyglihtllmtrvtfcgsrkihyifcemyvllrmacsniqinhtvli
atgcfiflipfgfviisyvliirailripsvskkykafstcashlgavsl
fygtlcmvylkplhtysvkdsvatvmyavvtpmmnpfiyslrnkdmhgal
grlldkhfkrlt