Return to CBI Antibody Core Home Page
  Return to human list
    Return to human ( Homo sapiens ) list


human ( Homo sapiens )
des


Links to multiple antibodies on this page for des:
des
des

Antibody Name/Abbreviation: des
CBI Antibody Core Code: A1016LCTT5

"Lot" Number: 1 Position: 14 (1-14)
% Identical Homology of Target to Mouse Protein: 100% (NP_034642.1| insulin-like growth factor 1)
Molecular Weight of GST-fusion: N.A. KDa

Target sequence used to make this antibody:
TLCGAELVDALQFV






Antibody Name/Abbreviation: des
CBI Antibody Core Code: A1017s

"Lot" Number: 1 Position: FL (1-67)
% Identical Homology of Target to Mouse Protein: 94% (NP_034642.1| insulin-like growth factor 1)
Molecular Weight of fusion protein: 21.37 KDa

Target sequence used to make this antibody:
tlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgi
vdeccfrscdlrrlemycaplkpaksa






Sequence Name: des
Full name: des(1-3)IGF-I
UniGene Number: N.A.
Accession Number: N.A.
Source organism: human ( Homo sapiens )
Full length size (aa): 67
NCBI information page:

Full length sequence:
tlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscd
lrrlemycaplkpaksa





Questions? Click here for answers.


© Monday, February 16, 2009 by the CBI Antibody Core and the Center for Biomedical Inventions, University of Texas Southwestern Medical School.