Links to multiple antibodies on this page for des: des des Antibody Name/Abbreviation: des CBI Antibody Core Code: A1016LCTT5 "Lot" Number: 1 Position: 14 (1-14) % Identical Homology of Target to Mouse Protein: 100% (NP_034642.1| insulin-like growth factor 1) Molecular Weight of GST-fusion: N.A. KDa Target sequence used to make this antibody: TLCGAELVDALQFV
Antibody Name/Abbreviation: des CBI Antibody Core Code: A1017s "Lot" Number: 1 Position: FL (1-67) % Identical Homology of Target to Mouse Protein: 94% (NP_034642.1| insulin-like growth factor 1) Molecular Weight of fusion protein: 21.37 KDa Target sequence used to make this antibody: tlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgi
vdeccfrscdlrrlemycaplkpaksa
| | Sequence Name: des Full name: des(1-3)IGF-I UniGene Number: N.A. Accession Number: N.A. Source organism: human ( Homo sapiens ) Full length size (aa): 67 NCBI information page: Full length sequence: tlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscd
lrrlemycaplkpaksa
|