human ( Homo sapiens )
G gamma2

Antibody Name/Abbreviation: G gamma2
CBI Antibody Core Code: A0392
"Lot" Number: 1 Position: 20(42-61)
% Identical Homology of Target to Mouse Protein: 100% (NP_034445.1| guanine nucleotide binding protein (G protein), gamma 2 subunit)
Molecular Weight of GST-fusion: 32.2 KDa

Target sequence used to make this antibody:
EAHAKEDPLLTPVPASENPF

Sequence Name: G gamma2
Full name:
UniGene Number: N.A.
Accession Number: N.A.
Source organism: human ( Homo sapiens )
Full length size (aa): 70
NCBI information page:

Full length sequence:
MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPL
LTPVPASENPFREKKFFCAIL