human ( Homo sapiens )
L2-b

Western result: +

GST GST-L2 A1007a (fragment)

25 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: L2
CBI Antibody Core Code: A1007a
"Lot" Number: 1 Position: 100 (70-169)
% Identical Homology of Target to Mouse Protein: 38% (XP_283676.3| similar to CDC42-binding protein kinase alpha; mytonic dystrophy kinase-related Cdc42-binding kinase)
Molecular Weight of fusion protein: 25 KDa

Target sequence used to make this antibody:
EDAPLRARPAAASPRAEPWLSQPASGSAYATPGAYGDIRP
SAASWVGSRGLAYPARPAQLRRRASVRGSSEEDEDARTPD
RATQGPGLAARRWWAASPAP

Western result: +

GST GST-L2-b A1007b (fragment)

17.85 kDa (recombinant)

The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST.

Antibody Name/Abbreviation: L2-b
CBI Antibody Core Code: A1007b
"Lot" Number: 1 Position: 35 (120-154)
% Identical Homology of Target to Mouse Protein: 43% (NP_898914.2| RIKEN cDNA 2810439M11)
Molecular Weight of fusion protein: 17.85 KDa

Target sequence used to make this antibody:
LAYPARPAQLRRRASVRGSSEEDEDARTPDRATQG

Sequence Name: L2-b
Full name: hypothetical protein LOC221496
UniGene Number: N.A.
Accession Number: NP_851853
Source organism: human ( Homo sapiens )
Full length size (aa): 503
NCBI information page:

Full length sequence:
MAGLSDLELRRELQALGFQPGPITDTTRDVYRNKLRRLRGEARLRDEERL
REEARPRGEERLREEARLREDAPLRARPAAASPRAEPWLSQPASGSAYAT
PGAYGDIRPSAASWVGSRGLAYPARPAQLRRRASVRGSSEEDEDARTPDR
ATQGPGLAARRWWAASPAPARLPSSLLGPDPRPGLRATRAGPAGAARARP
EVGRRLERWLSRLLLWASLGLLLVFLGILWVKMGKPSAPQEAEDNMKLLP
VDCERKTDEFCQAKQKAALLELLHELYNFLAIQAGNFECGNPENLKSKCI
PVMEAQEYIANVTSSSSAKFEAALTWILSSNKDVGIWLKGEDQSELVTTV
DKVVCLESAHPRMGVGCRLSRALLTAVTNVLIFFWCLAFLWGLLILLKYR
WRKLEEEEQAMYEMVKKIIDVVQDHYVDWEQDMERYPYVGILHVRDSLIP
PQSRRRMKRVWDRAVEFLASNESRIQTESHRVAGEDMLVWRWTKPSSFSD
SER