Return to CBI Antibody Core Home Page
  Return to human list
    Return to human ( Homo sapiens ) list


human ( Homo sapiens )
G gamma12



Western result: +
control
G gamma12
(fragment)

32.2 kDa (recombinant)
The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (recombinant fusion protein containing a His tag). The negative control lane is the same except it contains ~50ng to 100 ng of a recombinant fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used.

Antibody Name/Abbreviation: G gamma12
CBI Antibody Core Code: A0397

"Lot" Number: 1 Position: 20(1-20)
% Identical Homology of Target to Mouse Protein: 100% (NP_079554.1| guanine nucleotide binding protein (G protein), gamma 12; EST AA536815; EST AI314170; EST AI115529)
Molecular Weight of GST-fusion: 32.2 KDa

Target sequence used to make this antibody:
MSSKTASTNSIAQARRTVQQ






Sequence Name: G gamma12
Full name:
UniGene Number: N.A.
Accession Number: N.A.
Source organism: human ( Homo sapiens )
Full length size (aa): 72
NCBI information page:

Full length sequence:
MSSKTASTNSIAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSD
PLLIGIPTSENPFKDKKTCIIL





Questions? Click here for answers.


© Monday, February 16, 2009 by the CBI Antibody Core and the Center for Biomedical Inventions, University of Texas Southwestern Medical School.