Return to CBI Antibody Core Home Page
  Return to human list
    Return to human ( Homo sapiens ) list


human ( Homo sapiens )
X1


Antibody Name/Abbreviation: X1
CBI Antibody Core Code: A0997

"Lot" Number: 1 Position: 20 (37-56)
% Identical Homology of Target to Mouse Protein: 94% (NP_694754.1| otospiralin; organ of Corti 10 kDa protein)
Molecular Weight of GST-fusion: N.A. KDa

Target sequence used to make this antibody:
MPYWPFSTSDFWNYVQHFQA






Sequence Name: X1
Full name:
UniGene Number: N.A.
Accession Number: N.A.
Source organism: human ( Homo sapiens )
Full length size (aa): 89
NCBI information page:

Full length sequence:
MQACMVPGLALCLLLGPLAGAKPVQEEGDPYAELPAMPYWPFSTSDFWNY
VQHFQALGAYPQIEDMARTFFAHFPLGSTLGFHVPYQED





Questions? Click here for answers.


© Monday, February 16, 2009 by the CBI Antibody Core and the Center for Biomedical Inventions, University of Texas Southwestern Medical School.