| Antibody Name/Abbreviation: X1 CBI Antibody Core Code: A0997 "Lot" Number: 1 Position: 20 (37-56) % Identical Homology of Target to Mouse Protein: 94% (NP_694754.1| otospiralin; organ of Corti 10 kDa protein) Molecular Weight of GST-fusion: N.A. KDa Target sequence used to make this antibody: MPYWPFSTSDFWNYVQHFQA
| | Sequence Name: X1 Full name: UniGene Number: N.A. Accession Number: N.A. Source organism: human ( Homo sapiens ) Full length size (aa): 89 NCBI information page: Full length sequence: MQACMVPGLALCLLLGPLAGAKPVQEEGDPYAELPAMPYWPFSTSDFWNY
VQHFQALGAYPQIEDMARTFFAHFPLGSTLGFHVPYQED
|