human ( Homo sapiens )
G gamma11

Antibody Name/Abbreviation: G gamma11
CBI Antibody Core Code: A0388
"Lot" Number: 1 Position: 20(1-20)
% Identical Homology of Target to Mouse Protein: 100% (NP_079607.1| guanine nucleotide binding protein (G protein), gamma 11)
Molecular Weight of GST-fusion: 16.2 KDa

Target sequence used to make this antibody:
MPALHIEDLPEKEKLKMEVE

Sequence Name: G gamma11
Full name:
UniGene Number: N.A.
Accession Number: N.A.
Source organism: human ( Homo sapiens )
Full length size (aa): 73
NCBI information page:

Full length sequence:
MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGE
DPLVKGIPEDKNPFKEKGSCVIS