Links to multiple antibodies on this page for HCRTR2: HCRTR2 HCRTR2-pep Western result: + | | GST
 | GST-HCRTR2 A0991 (fragment)
 | | | | | | The western blot contains a test lane of ~20ug of a total protein extract from E coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein). The negative control lane is the same except it contains ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen. The blot was probed with a final antisera dilution of 1:1,000. The secondary antibody (Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated (Pierce)) is used at 1:5,000 dilution. Note, the molecular weight of the band on the western blot does not correspond to the molecular weight of the natural protein because only a fragment of the gene is used and it is fused to GST. | | Antibody Name/Abbreviation: HCRTR2 CBI Antibody Core Code: A0991 "Lot" Number: 1 Position: 50 (1-50) % Identical Homology of Target to Mouse Protein: 92% (NP_945200.1| hypocretin (orexin) receptor 2) Molecular Weight of fusion protein: 32.5 KDa Target sequence used to make this antibody: MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFL
RYLWREYLHP
Antibody Name/Abbreviation: HCRTR2-pep CBI Antibody Core Code: A0983 "Lot" Number: 1 Position: 20 (23-42) % Identical Homology of Target to Mouse Protein: 100% (NP_945200.1| hypocretin (orexin) receptor 2) Molecular Weight of GST-fusion: 29.2 KDa Target sequence used to make this antibody: ETQEPFLNPTDYDDEEFLRY
| | Sequence Name: HCRTR2 Full name: Human orexin receptor HCRTR2 UniGene Number: N.A. Accession Number: N.A. Source organism: human ( Homo sapiens ) Full length size (aa): 444 NCBI information page: Full length sequence: MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHP
KEYEWVLIAGYIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLAD
VLVTITCLPATLVVDITETWFFGQSLCKVIPYLQTVSVSVSVLTLSCIAL
DRWYAICHPLMFKSTAKRARNSIVIIWIVSCIIMIPQAIVMECSTVFPGL
ANKTTLFTVCDERWGGEIYPKMYHICFFLVTYMAPLCLMVLAYLQIFRKL
WCRQIPGTSSVVQRKWKPLQPVSQPRGPGQPTKSRMSAVAAEIKQIRARR
KTARMLMVVLLVFAICYLPISILNVLKRVFGMFAHTEDRETVYAWFTFSH
WLVYANSAANPIIYNFLSGKFREEFKAAFSCCCLGVHHRQEDRLTRGRTS
TESRKSLTTQISNFDNISKLSEQVVLTSISTLPAANGAGPLQNW
|